Skip to main content

Quantitative proteomic characterization of human sperm cryopreservation: using data-independent acquisition mass spectrometry



Human sperm cryopreservation is a simple and effective approach for male fertility preservation.


To identify potential proteomic changes in this process, data-independent acquisition (DIA), a technology with high quantitative accuracy and highly reproducible proteomics, was used to quantitatively characterize the proteomics of human sperm cryopreservation.


A total of 174 significantly differential proteins were identified between fresh and cryoperservated sperm: 98 proteins decreased and 76 proteins increased in the cryopreservation group. Bioinformatic analysis revealed that metabolic pathways play an important role in cryopreservation, including: propanoate metabolism, glyoxylate and dicarboxylate metabolism, glycolysis/gluconeogenesis, and pyruvate metabolism. Four different proteins involved in glycolysis were identified by Western blotting: GPI, LDHB, ADH5, and PGAM1.


Our work will provide valuable information for future investigations and pathological studies involving sperm cryopreservation.

Peer Review reports


Human sperm cryopreservation plays an important role in the treatment of male infertility when the male partner has severe abnormalities in semen parameters [1]. Furthermore, this technique is a simple and effective approach to male fertility preservation [2, 3], and is the only approach used in the clinic in many countries [4]. However, the cryopreservation protocols will induce a notable decrease in sperm motility, as well as affecting other parameters, including: membrane and acrosome integrity, DNA fragment, and reactive oxygen species [5, 6]. Certain intracellular and extracellular factors have been shown to lead to cryo-damage [7, 8]. However, the related pathogenesis of sperm cryo-damage during the process of cryopreservation shaould be clarified by further study.

Proteomics, especially sperm proteomics, is a new field in human reproduction studies. Ptoteomics can elucidate complex biological systems, including sperm motility and fertilization, and it can discover the potential pathogenic mechanisms and the biomarkers associated with male infertility [9, 10]. Data-independent acquisition (DIA) is, a novel proteomics technology, based on acquiring fragment ion information for all precursor ions within a certain range of m/z values [11]. Different from data-dependent acquisition (DDA), the DIA strategy has the characteristics of high quantitative accuracy and high reproducibility; and the experimental method has broad applicability: up to 5000 proteins can be detected and quantified in one experiment [11, 12]. To the best of our knowledge, this technique has not previously been applied to the study of human cryopreserved sperm.

For these reasons, the aim of the current study is to compare the proteomic differences between fresh and cryopreserved human sperm, using DIA mass data. A further understanding the sperm proteins would be very helpful in explaining sperm cryoinjury and may establish biomarkers for sperm motility.


Ethics statement and sample collection

The study was approved by National Research Institute for Family Planning Ethics Committee on Human Subjects (2018018). Ejaculates were obtained from healthy semen donors attending the Human Sperm Bank, National Research Institute for Family Planning, in Beijing China. Informed consent was obtained from all the sperm donors involved in the study.

Study design and sample collection

Paired design was applied to this study. Every semen sample was divided into two parts: one for the cryopreserved group and the other for the fresh group. Our focus was the difference between the cryopreserved and fresh human sperm.

A total of 14 semen samples from 14 qualified healthy sperm donors were collected. The ages of the sperm donors were between 22 years and 29 years. One ejaculate was collected from these volunteers by masturbation after 3–5 days of sexual abstinence. Routine semen analyses were performed by Computer Aided Sperm Analysis (CASA)(HTM-IVOS, USA), according to the World Health Organization (WHO 2010) guidelines.

Among the whole sample of each group, 9 cryopreserved and fresh samples were used for proteomics analysis. Similar to the previous study [13], the 9 donors’ ejaculates (each one divided into fresh and cryopreserved vials) were divided into 3 groups of 3. Then 5 for Western blot analysis.

Semen cryopreservation protocols

After complete liquefaction, 2 mL of each semen sample was divided into two parts: one for cryopreservation and the other placed in a 37 °C water bath as the control. Glycerol-egg-yolk-citrate (GEYC) was used as cryoprotectant containing 15% glycerol, 20% egg yolk, 1.3% glycine, 1.5% glucose, and 1.3% sodium citrate tribasic dehydrate, with a pH of 6.8–7.2. One volume of GEYC was added to two volumes of semen, drop by drop with swirling, and the mixture was incubated at 30–35 °C for 5 min. A slow sperm freezing method was performed according to the standardized programmable freezers (Kryo 360–1.7, Planner, United Kingdom) in our unit [12, 14]. Briefly, one volume of GEYC cryoprotectant was added to two volumes of semen, and the program was as follows: the samples tubes waerw cooled at 1.5 °C per minute from 20 °C to − 6 °C, at 6 °C per minute to − 100 °C, and at − 100 °C for 30 min, then the sample tubes were transferred to liquid nitrogen. After being preserved in the liquid nitrogen for a minimum of 2 days, a small portion (10 μL) of the frozen sample was thawed for sperm quality assessment.

Protein extraction and digestion

Protein extraction and digestion were performed as described previously [15]. The fresh and cryopreserved semen were centrifuged at 800 g for 10 min to remove seminal plasma, round cells and the cryoprotectant. Then, the sperm were washed three times with phosphate-buffered saline (PBS). Five hundred microliters of lysis buffer [8 M UREA, 100 mM Tris-HCl, pH 7.6, 1 mM PMSF (phenylmethylsulfonyl fluoride)(Roche, Germany)] was added to each sample. Then, the samples were sonicated(Sonics, USA) at 20 joules for 2 s × 10 at intervals of 15 s, and centrifuged at 18000 g for 15 min, after which the supernatant was extracted. Quantification was performed using the BCA method. The protein sample was frozen at − 80 °C. An aliquot of 20 μg was used for each sample to build the mixed and pooled library. Six samples and the pooled samples were subjected to enzymatic hydrolysis using a FASP (filter-aided sample preparation) enzymatic method.

Then, protein digestion was performed using the FASP protocol. In brief, protein (200 μg) was diluted with 50 mM dithiothreitol and incubated for 40 min at 56 °C. Further operation was carried out using the ultrafiltration tube method. The ultrafiltration tube was placed in a collection tube, and the protein sample was added to the ultrafiltration tube and centrifuged at 12000 g for 15 min. One hundred microliters of urea buffer containing 50 mM iodoacetamide was added to the ultrafiltration tube and it was then incubated for 20 min in the dark. The sample was washed twice by adding 100 μL urea buffer and centrifugede at 12000 g for 10 min to remove irrelevant substances. Then, 80 μL of 50 mM trypsin in NH4HCO3 was added to ultrafiltration tube, and the protein-to-enzyme ratio was 50:1. The samples were incubated at 37 °C for 16 h, and the released peptides were collected through centrifugation and directly determined by the protein concentration detection mode in the Nano-Drop instrument.

Spectral library generation

The samples (1 μg) were analyzed on an EASY-Nano-LC mass spectrometer (Thermo, USA). The peptides were separated using 0.1% formic acid, containing iRT standard peptide(Buffer A) and acetonitrile containing 0.1% formic acid(Buffer B), along a linear gradient from 3 to 32% at 300 nL/min for 120 min. The gradient of chromatographic separation was as follows: 3–7% buffer B for 0-3 min, 7–20% buffer B for 80 min,20–32% buffer B for 24 min, 32–90% buffer B for 1 min, and 100% buffer B for 120 min. For DDA, the source was operated by Orbitrap Fusion (Thermo Scientific, USA), at 2.1 kV. The DDA scheme included a full MS survey scan from m/z350 to m/z 1500 at a resolution of 60 k full-width half-maximum (FWHM)(at m/z 200) with automatic gain control(AGC) set to 4E5 (maximum injection time of 50 ms). The parameters of MS2 were as follows: 30 k FWHM (@ m/z 200), isolation window 1.6 Th, AGC set to 4e5 (maximum injection time of 50 ms). For, high-energy collision dissociation (HCD): MS2 Activation (collision energy: 35) was used, and dynamic exclusion was set to 40s.

For the generation of the spectral library, DDA data analysis was performed using Protein Discoverer 2.1 SP1(SEQUEST HT). The database is human proteins database from UniProt: “uniprot-organism-9606 + reviewed-yes.fasta,” and iRT peptide sequences were added to the database: (>Biognosys|iRT-Kit|Sequence_fusion LGGNEQVTRYILAGVENSKGTFIIDPGGVIRGTFIIDPAAVIRGAGSSEPVTGLDAKTPVISGGPYEYRVEATFGVDESNAKTPVITGAPYEYRDGLDAASYYAPVRADVTPADFSEWKLFLQFGAQGSSPFLK).

Raw data were analyzed according to the user guide of the software. The parameters were set as follows: the initial mass tolerance for precursor ions was: 10 ppm, and the mass tolerance for product ion spectra was 0.02 Da. Tryptic cleavage was selected, and the maximum allowable number of missing cleavage was 2. Carbamidomethyl of cysteine was set as the fixed modification, while oxidation of methionine and N terminal acetylation were set as variable modifiers. The identifications were filtered to satisfy an FDR of 1%, and the unique peptide number per protein was greater than one. Then, the result was used to build the DDA spectral library in Spectronaut Pulsar X(Biognosys, Switzerland). The library parameters used the default optimal parameter “GBS factory setting”.

Protein identification and quantitation

For DIA, 2 μg peptides was taken from each sample and mixed with appropriate iRT standard peptides. Each sample was tested by DIA mass spectrometry for 2 h. The method consisted of a full MS1 scan at a resolution of 60 K from m/z 350 to m/z 1500, with AGC set to 4E5 (maximum injection time of 50 ms), followed by 46 DIA windows acquired at a resolution of 30 K FWHM with AGC set to 5e5 (maximum injection time of 55 ms); HCD: MS2 activation (collision energy: 35).

Finally, qualitative and quantitative analyses of DIA raw data were performed in Spectronaut Pulsar X. Database parameters were as follows: peptides FDR\ PSM FDR\ proteins FDR was 1%; at least three proteins were selected for each peptide, at most 6 optimal ion generation library spectra were selected, and iRT calibration R2 > 0.8. The quantitative parameters were set as follows: the iTR standard used a nonlinear fit (local (non-linear) regression), the protein identification used a precursor Qvalue cutoff 0.01, the protein Qvalue cutoff of 0.01, the protein quantification used the peak area of sub-ions, and the average Intensity of at least three sub-ions was selected to quantify the protein. Protein quantification uses the ion peak area, and at least the average intensity quantification of three sub-ions is selected. Paired t-test was used as the analytical approach and P-value of 0.05 was set.

Bioinformatics analysis

All significantly differential proteins were used as input. The OmicsBean analysis tool [16] was used to retrieve the Gene Ontology Consortium categories, including: molecular function (MF), cellular component (CC) and biological process (BP). KEGG [17] pathway enrichment analysis was performed using the Kanehisa databases web service ( The protein-protein interaction network (PPI) was constructed using the STRING [18] web service (

Western blotting

According to our previous experience [19], the sperm protein samples were separated by 10% SDS polyacrylamide gel electrophoresis. The samples were then transferred to a polyvinylidene fluoride membranes, blocked with 2% (w/v) skim milk for 1 h, and incubated overnight with the primary antibody of glucose-6-phosphate isomerase (GPI), lactate dehydrogenase B (LDHB), alcohol dehydrogenase 5 (ADH5), and phosphoglycerate mutase 1 (PGAM1) (1:1000) (Abclone, China) at 4 °C temperature. After three washes with TBST, the membranes were incubated with horseradish peroxidase (HRP) in combination with anti-IgG for 1 h at room temperature (18–22 °C). Enhanced chemiluminescence revealed immunoreactivity. The relative signal intensity of protein bands was analyzed with Quantity One v.4.6.2.

Statistical analysis

Data are expressed as the mean ± SD and were analyzed with SPSS22.0 software (IBM, USA). Paired t-test was used as the analytical approach, and a P-value of 0.05 was set.


Sperm motility

We aimed to assess the impact of cryopreservation on sperm motility (Table 1). Compared with fresh semen, a significant decrease in the percentage of progressive sperm, and sperm motion parameters was observed in cryoperserved sperm, including average path velocity (VAP), straight line velocity (VSL), and curvilinear velocity (VCL).

Table 1 Characteristics of motility of fresh and post-thaw human sperm (n = 14) (Mean ± SD)

Quantitative results of differential proteins

Compared with the spectral library, a total of 29,495 unique peptides and 5246 proteins were identified. Finally, 3790 proteins were quantitatively analyzed. Using the 1.5-fold or 0.67-fold change and the FDR-adjusted p-value of 0.05 as cutoffs, 174 (4.6%) significantly differential proteins were identified between fresh and cryopreserved sperm: 76 were increased and 98 were decreased in the cryopreserved group. The detail of the differential proteins due to cryopreservtaion are provided in the Additional file 1: Table S1.

Gene ontology enrichment

Enrichment analysis was performed based on the 174 significantly deregulated proteins. A total of 1544 biological processes(BPs), 275 cell components(CCs) and 261 molecular functions(MFs) were involved in the GO enrichment, and there were significant differences between the fresh and cryopreserved sperm(P < 0.05). The number of differential proteins contained in each entry and its percentage of total differential protein are shown in Fig. 1. The detailed results of the GO enrichment are provided in Additional file 2: Table S2.

Fig. 1

Gene Ontology analysis classification and the enrichment result of differentially expressed proteins in the human freeze-thaw samples compared to the fresh group, in terms of Biological Process, Cell Component and Molecular Function

KEGG pathway and protein-protein interaction (PPI) network analysis

Pathway enrichment analysis was also performed by KEGG enrichment in order to identify the major biochemical pathways and signal transduction pathways. Several pathways were significantly disturbed in cryopreserved sperm, such as: ribosome, carbon metabolism and lysosome (Fig. 2). The details of the 16 pathways with significant differences are shown in Table 2. To show the main interactions and regulatory relationships of these proteins, the PPI network was constructed (Fig. 3).

Fig. 2

Kyoto Encyclopedia of Genes and Genomes(KEGG) pathway enrichment analysis

Table 2 Detailed information of the Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway enrichment results
Fig. 3

Protein interaction network diagram (STRING)

According to the KEGG analysis, the results showed found that the metabolic pathways play an important role in cryopreservation (Fig. 2), including: propanoate metabolism, glyoxylate and dicarboxylate metabolism, glycolysi/gluconeogenesis, and pyruvate metabolism. Most of these pathways were down regulated in the cryopreserved sperm group (the green in the Fig. 3).

Validation of the glycolysis metabolic proteins

To further validate the outcome of the KEGG analysis, we used Western blotting to quantify the four dysregulated protein enzymes in glycolysis: GPI, LDHB, ADH5, and PGAM1.

These protein analysis results confirmed the previous genomic analysis of metabolomics, and the results confirmed the differential protein levels observed via 2DE (Fig. 4). The cryopreserved group had lower levels of GPI, LDHB, and PGAM1. and a higher level of ADH5 than the fresh sperm (Fig. 4).

Fig. 4

Validation of the 2DE results by Western blot


Worldwide, the percentage of male infertility ranges between 20 and 70% [20], and men with azoospermia or severe oligozoospermia will benefit from sperm cryopreservation. Furthermore, cryopreservation is a simple and effective technique for preserving fertility potential [4, 21]. However, after sperm cryopreservation, too many sperm lose their motility and fertility [5, 22]. Some sperm proteins have been recognized to be associated with sperm quality, and the loss of these proteins may be responsible for the decrease in fertility in sperm cryopreservation, such as: heat-shock protein 90 [23] and, Enolase1 (ENO1). However single protein bioresearch can only partly explain the cryodamage, and further study should be based on direct or indirect protein-protein interaction and mechanistic factors.

Proteomics technology has been identified as valuable tool for sperm [15, 24, 25]. Proteomic changes in human sperm as a result of cryoinjury have been reported previously. Wang [13] found twenty-seven proteins that differed in abundance between fresh and cryopreserved sperm, by using two-dimensional polyacrylamide gel electrophoresis (2-DE) and mass spectrometry. However 2-DE has its limitations, including a low sensitivity of the densitometry analysis. Bogle et al. [26] used tandem mass tag (TMT) technology to identify potential proteomic changes at every stage of the cryopreservation process, but they did not compare fresh and cryopreserved sperm. Different from TMT, the DIA strategy has the characteristics of high quantitative accuracy and high reproducibility [11, 27]. Due to its global nature and enormous multiplexing capacity, DIA has been widely used in mechanistic studies and clinical biomarker screening in human reproduction for the enhanced protein coverage and analytical reproducibility [28]. In our study, a total of 174 significantly differential proteins were identified from 3790 quantitatively analyzed proteins, which is much more than previously reported discoveries [13, 26].

Improving upon previous studies on human cryopreserved sperm proteomics analysis [13, 26], our study performed KEGG analysis for the different proteins. KEGG is a frontier interdisciplinary subject based on life science and computer science. Bioinformatics analysis has been widely used as a powerful tool for data processing and prediction by employing various databases, and it has been widely used in the discovery of new biomarkers and the study of new therapeutic targets [29, 30]. According to the KEGG analysis, the present study revealed that the metabolic pathways were affected by cryopreservation. This result confirmed previous research. Wang et al. found the decreased abundance of succinyl-CoA:3-ketoacid CoA transferase (OXCT1) in cryopreservated sperm, and this enzyme is involved in ketone metabolism and might be associated with glycolysis in sperm [13]. According to Bogle et al. [26], energy- and metabolism- related proteins account for 15% of the collated differential proteins.

Different studies have proven that the pathway of carbon metabolism is associated with sperm and male infertility [31]. In addition, sperm are highly specialized mammalian cells; the sperm must reserve enough adenosine triphosphate (ATP) to maintain the physiological processes, including motility, capacitation, hyperactivation, acrosome reaction and fertilization, all of which are highly energy dependent processes. The ATP is formed via two metabolic pathways: glycolysis and oxidative phosphorylation (OXPHOS) [32], which are extremely down regulated in the post-thaw sperm. The present study is beneficial for the further study of energy metabolic pathways involved in cryoinjury.

While many studies have reported that glycolysis is the primary source of ATP during sperm motility [32,33,34], OXPHOS is involved in maturation and differentiation [35]. Many study have also shown that sperm motility will significantly decrease in the process of cryopreservation and that ATP is extremely decrease in the post-thaw sperm [5, 36, 37]. Based on thede results, we focuesd the glycolysis pathway in future research. The four proteins related to glycolysis were identified by Western boltting. This study shows the a correlation between GPI and sperm motility. Consistent with previous research [37], our study show that GPI is an important factor of thawed sperm. The variability of LDHB in the process of sperm cryopreservation has also been identified in the sturgeon [38]. Early research suggests that PGAM [39] and ADH [40] is associated with spermatogenic distinction and affects the function of cell proliferation, apoptosis and migration. Further research on the correlation between PGAM1/ADH and sperm cryopreservation requiresis needed.


Human sperm cryopreservation is a simple and effective approach for male fertility preservation. To identify potential proteomic changes in this process, Data-independent acquisition (DIA), a proteomics technology with high quantitative accuracy and high reproducibility was used to quantitatively characterize the proteomics of human sperm cryopreservation. A total of 174 significantly differential proteins were identified between fresh and cryoperservated sperm: 98 were decreased and 76 were increased in the cryopreservation group. Bioinformatic analysis revealed that metabolic pathways play an important role in cryopreservation, including propanoate metabolism, glyoxylate and dicarboxylate metabolism, glycolysi/gluconeogenesis, and pyruvate metabolism. The four different proteins involved in glycolysis were identified by Western Blotting: GPI, LDHB, ADH5, and PGAM1. Our work will provide valuable information for future investigations and pathological studies involving sperm cryopreservation.

Availability of data and materials

The datasets for the current study are available from the corresponding author upon reasonable request.



Biological process


Cellular component


Data-dependent acquisition


Data-independent acquisition


Full-Width Half-Maximum


Molecular function


Protein-protein interaction


Average path velocity


Curvilinear velocity


Straight line velocity


  1. 1.

    Yogev L, Kleiman SE, Shabtai E, Botchan A, Paz G, Hauser R, Lehavi O, Yavetz H, Gamzu R. Long-term cryostorage of sperm in a human sperm bank does not damage progressive motility concentration. Hum Reprod. 2010;25(5):1097–103.

    CAS  Article  Google Scholar 

  2. 2.

    Tournaye H, Dohle GR, Barratt CL. Fertility preservation in men with cancer. Lancet. 2014;384(9950):1295–301.

    Article  Google Scholar 

  3. 3.

    Oktay K, Harvey BE, Partridge AH, Quinn GP, Reinecke J, Taylor HS, Wallace WH, Wang ET, Loren AW. Fertility Preservation in Patients With Cancer: ASCO Clinical Practice Guideline Update. J Clin Oncol. 2018;36(19):1994-2001.

    Article  Google Scholar 

  4. 4.

    Fu L, Zhang K, An Q, Zhou F, Lu W, Liang X, Gu Y. Low utilization of fertility preservation among Chinese male cancer patients. Int J Clin Exp Med. 2018;11(9):9916–20.

    Google Scholar 

  5. 5.

    Raad G, Lteif L, Lahoud R, Azoury J, Azoury J, Tanios J, Hazzouri M, Azoury J. Cryopreservation media differentially affect sperm motility, morphology and DNA integrity. Andrology. 2018;6(6):836-45.

    CAS  Article  Google Scholar 

  6. 6.

    Gomez-Torres MJ, Medrano L, Romero A, Fernandez-Colom PJ, Aizpurua J. Effectiveness of human spermatozoa biomarkers as indicators of structural damage during cryopreservation. Cryobiology. 2017;78:90–4.

    CAS  Article  Google Scholar 

  7. 7.

    Ribas-Maynou J, Fernandez-Encinas A, Garcia-Peiro A, Prada E, Abad C, Amengual MJ, Navarro J, Benet J. Human semen cryopreservation: a sperm DNA fragmentation study with alkaline and neutral comet assay. Andrology. 2014;2(1):83–7.

    CAS  Article  Google Scholar 

  8. 8.

    Kathrins M, Abhyankar N, Shoshany O, Liebermann J, Uhler M, Prins G, Niederberger C. Post-thaw recovery of rare or very low concentrations of cryopreserved human sperm. Fertil Steril. 2017;107(6):1300–4.

    Article  Google Scholar 

  9. 9.

    De Rose MB, Piccolomini MM, Belo ASS, Borges E, Jr., Filho FF: Proteomics in Human Reproduction. Protein and peptide letters 2018.

  10. 10.

    Cao X, Cui Y, Zhang X, Lou J, Zhou J, Bei H, Wei R. Proteomic profile of human spermatozoa in healthy and asthenozoospermic individuals. Reprod Biol Endocrinol. 2018;16(1):16.

    Article  Google Scholar 

  11. 11.

    Tsou CC, Avtonomov D, Larsen B, Tucholska M, Choi H, Gingras AC, Nesvizhskii AI. DIA-Umpire: comprehensive computational framework for data-independent acquisition proteomics. Nat Methods. 2015;12(3):258–64 257 p following 264.

    CAS  Article  Google Scholar 

  12. 12.

    Yang X, Guo Y, Cao XF, Jia YF, Wang XW, Xu JF, Zhou F, Li H, Liang XW, Lu WH, et al. Effect of cryopreservation on DNA methylation status of imprited genes in human sperm. J Reprod Medcine. 2015;24(5):402–8.

    CAS  Google Scholar 

  13. 13.

    Wang S, Wang W, Xu Y, Tang M, Fang J, Sun H, Sun Y, Gu M, Liu Z, Zhang Z, et al. Proteomic characteristics of human sperm cryopreservation. Proteomics. 2014;14(2–3):298–310.

    CAS  Article  Google Scholar 

  14. 14.

    Hezavehei M, Sharafi M, Kouchesfahani HM, Henkel R, Agarwal A, Esmaeili V, Shahverdi A. Sperm cryopreservation: a review on current molecular cryobiology and advanced approaches. Reprod BioMed Online. 2018;37(3):327–39.

    CAS  Article  Google Scholar 

  15. 15.

    Wang G, Wu Y, Zhou T, Guo Y, Zheng B, Wang J, Bi Y, Liu F, Zhou Z, Guo X, et al. Mapping of the N-linked glycoproteome of human spermatozoa. J Proteome Res. 2013;12(12):5750–9.

    CAS  Article  Google Scholar 

  16. 16.

    Li F, Zhao D, Yang S, Wang J, Liu Q, Jin X, Wang W. ITRAQ-based proteomics analysis of Triptolide on human A549 lung adenocarcinoma cells. Cell Physiol Biochem. 2018;45(3):917–34.

    CAS  Article  Google Scholar 

  17. 17.

    Kanehisa M, Furumichi M, Tanabe M, Sato Y, Morishima K. KEGG: new perspectives on genomes, pathways, diseases and drugs. Nucleic Acids Res. 2017;45(D1):D353–d361.

    CAS  Article  Google Scholar 

  18. 18.

    Szklarczyk D, Franceschini A, Wyder S, Forslund K, Heller D, Huerta-Cepas J, Simonovic M, Roth A, Santos A, Tsafou KP, et al. STRING v10: protein-protein interaction networks, integrated over the tree of life. Nucleic Acids Res. 2015;43(Database issue):D447–52.

    CAS  Article  Google Scholar 

  19. 19.

    Liu Y, Wang J, Qin Y, Huang C, Archacki S, Ma J, Li D, Liu M. Identification of three mutations in the MVK gene in six patients associated with disseminated superficial actinic porokeratosis. Clinica Chimica Acta; Int J Clin Chem. 2016;454:124–9.

    CAS  Article  Google Scholar 

  20. 20.

    Agarwal A, Mulgund A, Hamada A, Chyatte MR. A unique view on male infertility around the globe. Reprod Biol Endocrinol. 2015;13:37.

    Article  Google Scholar 

  21. 21.

    Nahata L, Caltabellotta NM, Yeager ND, Lehmann V, Whiteside SL, O'Brien SH, Quinn GP, Gerhardt CA: Fertility perspectives and priorities among male adolescents and young adults in cancer survivorship. Pediatric blood & cancer 2018.

  22. 22.

    Isaac AV, Kumari S, Nair R, Urs DR, Salian SR, Kalthur G, Adiga SK, Manikkath J, Mutalik S, Sachdev D, et al. Supplementing zinc oxide nanoparticles to cryopreservation medium minimizes the freeze-thaw-induced damage to spermatozoa. Biochem Biophys Res Commun. 2017;494(3–4):656–62.

    CAS  Article  Google Scholar 

  23. 23.

    Cao WL, Wang YX, Xiang ZQ, Li Z. Cryopreservation-induced decrease in heat-shock protein 90 in human spermatozoa and its mechanism. Asian J Androl. 2003;5(1):43–6.

    CAS  PubMed  Google Scholar 

  24. 24.

    Li CJ, Wang D, Zhou X. Sperm proteome and reproductive technologies in mammals. Anim Reprod Sci. 2016;173:1–7.

    CAS  Article  Google Scholar 

  25. 25.

    Kosteria I, Anagnostopoulos AK, Kanaka-Gantenbein C, Chrousos GP, Tsangaris GT. The Use of Proteomics in Assisted Reproduction. In Vivo (Athens, Greece). 2017;31(3):267–83.

    CAS  Google Scholar 

  26. 26.

    Bogle OA, Kumar K, Attardo-Parrinello C, Lewis SE, Estanyol JM, Ballesca JL, Oliva R. Identification of protein changes in human spermatozoa throughout the cryopreservation process. Andrology. 2017;5(1):10–22.

    CAS  Article  Google Scholar 

  27. 27.

    Muntel J, Xuan Y, Berger ST, Reiter L, Bachur R, Kentsis A, Steen H. Advancing urinary protein biomarker discovery by data-independent acquisition on a Quadrupole-Orbitrap mass spectrometer. J Proteome Res. 2015;14(11):4752–62.

    CAS  Article  Google Scholar 

  28. 28.

    Meyer JG, D'Souza AK, Sorensen DJ, Rardin MJ, Wolfe AJ, Gibson BW, Schilling B. Quantification of lysine acetylation and Succinylation stoichiometry in proteins using mass spectrometric data-independent acquisitions (SWATH). J Am Soc Mass Spectrom. 2016;27(11):1758–71.

    CAS  Article  Google Scholar 

  29. 29.

    Chen L, Lu D, Sun K, Xu Y, Hu P, Li X, Xu F. Identification of biomarkers associated with diagnosis and prognosis of colorectal cancer patients based on integrated bioinformatics analysis. Gene. 2019.

  30. 30.

    Zhang Y, Tang X, Pang Y, Huang L, Wang D, Yuan C, Hu X, Qu L. The Potential Mechanism of Bufadienolide-Like Chemicals on Breast Cancer via Bioinformatics Analysis. Cancers (Basel). 2019;11(1):91.

    Article  Google Scholar 

  31. 31.

    Singh K, Jaiswal D. One-carbon metabolism, spermatogenesis, and male infertility. Reprod Sci (Thousand Oaks, Calif). 2013;20(6):622–30.

    CAS  Article  Google Scholar 

  32. 32.

    du Plessis SS, Agarwal A, Mohanty G, van der Linde M. Oxidative phosphorylation versus glycolysis: what fuel do spermatozoa use? Asian J Androl. 2015;17(2):230–5.

    Article  Google Scholar 

  33. 33.

    Gibb Z, Aitken RJ. The impact of sperm metabolism during in vitro storage: the stallion as a model. Biomed Res Int. 2016;2016:9380609.

    Article  Google Scholar 

  34. 34.

    Hereng TH, Elgstoen KB, Cederkvist FH, Eide L, Jahnsen T, Skalhegg BS, Rosendal KR. Exogenous pyruvate accelerates glycolysis and promotes capacitation in human spermatozoa. Hum Reprod. 2011;26(12):3249–63.

    CAS  Article  Google Scholar 

  35. 35.

    Stendardi A, Focarelli R, Piomboni P, Palumberi D, Serafini F, Ferramosca A, Zara V. Evaluation of mitochondrial respiratory efficiency during in vitro capacitation of human spermatozoa. Int J Androl. 2011;34(3):247–55.

    CAS  Article  Google Scholar 

  36. 36.

    O'Connell M, McClure N, Lewis SE. The effects of cryopreservation on sperm morphology, motility and mitochondrial function. Hum Reprod. 2002;17(3):704–9.

    CAS  Article  Google Scholar 

  37. 37.

    Jiang XP, Wang SQ, Wang W, Xu Y, Xu Z, Tang JY, Sun HY, Wang ZJ, Zhang W. Enolase1 (ENO1) and glucose-6-phosphate isomerase (GPI) are good markers to predict human sperm freezability. Cryobiology. 2015;71(1):141–5.

    CAS  Article  Google Scholar 

  38. 38.

    Li P, Guo W, Yue H, Li C, Du H, Qiao X, Liu Z, Zhou Q, Wei Q. Variability in the protein profiles in spermatozoa of two sturgeon species. PLoS One. 2017;12(10):e0186003.

    Article  Google Scholar 

  39. 39.

    Zhang S, Zhao Y, Lei B, Li C, Mao X. PGAM1 is Involved in Spermatogenic Dysfunction and Affects Cell Proliferation, Apoptosis, and Migration. Reprod Sci (Thousand Oaks, Calif). 2015;22(10):1236–42.

    CAS  Article  Google Scholar 

  40. 40.

    Aly HA, El-Beshbishy HA, Banjar ZM. Mitochondrial dysfunction induced impairment of spermatogenesis in LPS-treated rats: modulatory role of lycopene. Eur J Pharmacol. 2012;677(1–3):31–8.

    CAS  Article  Google Scholar 

Download references


The authors wish to thank PhD. Guibin Wang, Beijing Proteome Research Center, forthe helpful assistance in DIA.


This work was supported by the CAMS Innovation Fund for Medical Sciences [2018-I2M-1-004], the Chinese Medical Association clinical medical research specific fund [18010310760], the National “13th Five-Year” Plan for Science and Technology Support [2018YFC1003601], Fundamental Research Funds for the Central Universities [3332018187], National Natural Science Foundation of China [81803116], and Suzhou Science & Technology Planning Project [sys2018077].

2018-I2M-1-004, 18010310760 and 2018YFC1003601 support the design of the study. 3332018187, 81803116 and sys2018077 were used for purchasing most of the experimental reagents, and materials.

Author information




LLF and YQG conceived and supervised the study design. LLF, QA, KSZ and YL established the mass spectrometry workflow and performed the proteomic analysis. YT, XWW, JFX, FZ and YG analyzed proteomic data and performed bioinformatics analysis. WHL and XWL verify and interpretation all the data. LLF and YL drafted the manuscript. YQG, WHL, and XWL revised the manuscript. All authors have read and approved the manuscript.

Corresponding authors

Correspondence to Wenhong Lu or Yiqun Gu.

Ethics declarations

Ethics approval and consent to participate

Experimental procedures were performed in accordance with the Ethical Principles in Human Research. The study was approved by National Research Institute for Family Planning Ethics Committee on human subjects (2018018). And written informed consent was obtained from all the sperm donors involved in the study.

Consent for publication

Not applicable

Competing interests


Additional information

Publisher’s Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Supplementary information

Additional file 1: Table S1.

The differential proteins due to cryopreservtaion.

Additional file 2: Table S2.

The results of the GO enrichment.

Rights and permissions

Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (, which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver ( applies to the data made available in this article, unless otherwise stated.

Reprints and Permissions

About this article

Verify currency and authenticity via CrossMark

Cite this article

Fu, L., An, Q., Zhang, K. et al. Quantitative proteomic characterization of human sperm cryopreservation: using data-independent acquisition mass spectrometry. BMC Urol 19, 133 (2019).

Download citation


  • Cryopreservation
  • Fertility preservation
  • Reproductive techniques, assisted
  • Metabolic networks and pathways